SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG13290_5prime_partial:A_SariASG_c37317_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		heat_shock-like_protein,_partial_[Mus_musculus]
Ontology
GO:0000166 F nucleotide binding
GO:0001764 P neuron migration
GO:0002134 F UTP binding
GO:0002135 F CTP binding
GO:0003009 P skeletal muscle contraction
GO:0003729 F mRNA binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005525 F GTP binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006457 P protein folding
GO:0006809 P nitric oxide biosynthetic process
GO:0006950 P response to stress
GO:0006986 P response to unfolded protein
GO:0009408 P response to heat
GO:0009409 P response to cold
GO:0009651 P response to salt stress
GO:0009986 C cell surface
GO:0010592 P positive regulation of lamellipodium assembly
GO:0010659 P cardiac muscle cell apoptotic process
GO:0016020 C membrane
GO:0016323 C basolateral plasma membrane
GO:0016324 C apical plasma membrane
GO:0016887 F ATP hydrolysis activity
GO:0017098 F sulfonylurea receptor binding
GO:0019901 F protein kinase binding
GO:0019903 F protein phosphatase binding
GO:0023026 F MHC class II protein complex binding
GO:0030235 F nitric-oxide synthase regulator activity
GO:0030911 F TPR domain binding
GO:0031012 C extracellular matrix
GO:0031396 P regulation of protein ubiquitination
GO:0031526 C brush border membrane
GO:0032564 F dATP binding
GO:0032587 C ruffle membrane
GO:0033160 P obsolete positive regulation of protein import into nucleus, translocation
GO:0042026 P protein refolding
GO:0042470 C melanosome
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0042826 F histone deacetylase binding
GO:0043005 C neuron projection
GO:0043025 C neuronal cell body
GO:0043209 C myelin sheath
GO:0043234 C protein-containing complex
GO:0043627 P response to estrogen
GO:0044325 F transmembrane transporter binding
GO:0044822 F RNA binding
GO:0045040 P protein insertion into mitochondrial outer membrane
GO:0045429 P positive regulation of nitric oxide biosynthetic process
GO:0045585 P positive regulation of cytotoxic T cell differentiation
GO:0045793 P positive regulation of cell size
GO:0046677 P response to antibiotic
GO:0048471 C perinuclear region of cytoplasm
GO:0050790 P regulation of catalytic activity
GO:0051020 F GTPase binding
GO:0051022 F Rho GDP-dissociation inhibitor binding
GO:0051082 F unfolded protein binding
GO:0051131 P chaperone-mediated protein complex assembly
GO:0060452 P positive regulation of cardiac muscle contraction
GO:0070062 C extracellular exosome
RNA-seq EntryA_SariASG_c37317_g1_i2
Sequence
(Amino Acid)
KKTKFENPCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNS
TMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQT
HANRIYRMIKLGLGIDEDDPTVDDTSAAVTEEMPPLEGDDDTSRMEEVD
*(55 a.a.)

- SilkBase 1999-2023 -