SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG1319_internal:A_SariASG_c12477_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
DE-cadherin_like_protein,_partial_[Danaus_plexippus_plexippus]
Ontology
GO:0000902 P cell morphogenesis
GO:0001738 P morphogenesis of a polarized epithelium
GO:0001745 P compound eye morphogenesis
GO:0001748 P insect visual primordium development
GO:0002009 P morphogenesis of an epithelium
GO:0003151 P outflow tract morphogenesis
GO:0004872 F signaling receptor activity
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005912 C adherens junction
GO:0005913 C adherens junction
GO:0005914 C spot adherens junction
GO:0005915 C zonula adherens
GO:0005938 C cell cortex
GO:0007155 P cell adhesion
GO:0007156 P homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007163 P establishment or maintenance of cell polarity
GO:0007280 P pole cell migration
GO:0007281 P germ cell development
GO:0007297 P ovarian follicle cell migration
GO:0007298 P border follicle cell migration
GO:0007314 P oocyte anterior/posterior axis specification
GO:0007370 P ventral furrow formation
GO:0007379 P segment specification
GO:0007399 P nervous system development
GO:0007409 P axonogenesis
GO:0007411 P axon guidance
GO:0007420 P brain development
GO:0007424 P open tracheal system development
GO:0007435 P salivary gland morphogenesis
GO:0007506 P gonadal mesoderm development
GO:0007507 P heart development
GO:0008013 F beta-catenin binding
GO:0008105 P protein localization
GO:0008258 P head involution
GO:0008354 P germ cell migration
GO:0008356 P asymmetric cell division
GO:0008406 P gonad development
GO:0010004 P gastrulation involving germ band extension
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016318 P ommatidial rotation
GO:0016337 P cell-cell adhesion
GO:0016339 P calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0016342 C catenin complex
GO:0017022 F myosin binding
GO:0030031 P cell projection assembly
GO:0030175 C filopodium
GO:0030708 P germarium-derived female germ-line cyst encapsulation
GO:0030720 P oocyte localization involved in germarium-derived egg chamber formation
GO:0035019 P somatic stem cell population maintenance
GO:0035099 P hemocyte migration
GO:0035147 P branch fusion, open tracheal system
GO:0035160 P maintenance of epithelial integrity, open tracheal system
GO:0035212 P cell competition in a multicellular organism
GO:0035262 P gonad morphogenesis
GO:0036099 P female germ-line stem cell population maintenance
GO:0042060 P wound healing
GO:0042078 P germ-line stem cell division
GO:0042803 F protein homodimerization activity
GO:0043296 C apical junction complex
GO:0044331 P cell-cell adhesion mediated by cadherin
GO:0045176 P apical protein localization
GO:0045186 P zonula adherens assembly
GO:0046872 F metal ion binding
GO:0048103 P somatic stem cell division
GO:0048477 P oogenesis
GO:0050832 P defense response to fungus
GO:0050839 F cell adhesion molecule binding
GO:0055037 C recycling endosome
GO:0071907 P determination of digestive tract left/right asymmetry
GO:0098730 P male germline stem cell symmetric division
RNA-seq EntryA_SariASG_c12477_g1_i1
Sequence
(Amino Acid)
ASFVPAASPKLAVKDNHKPLFTECLNYRPTVKEEQPVGTYVFTVHAEDRDPPEMGGTVTY
KFVSTPGEKERFHVDPETGRITTADIFDHDEPSREKEAYITVRASDNGQPQLDDACTIKI
LIEDINDNQPVFDKVSYSESVPQDLPSGREVMRISATDIDDGNNSIVHYKLDSNSPDQAY
FYIDPDNGVIFLNKTIDKPPGYKFKLSAIVTDTGIPPQQSSITLDIQVVESNKKS
(77 a.a.)

- SilkBase 1999-2023 -