SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG13159_complete:A_SariASG_c37235_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_calnexin_[Amyelois_transitella]
Ontology
GO:0001948 F protein binding
GO:0002474 P antigen processing and presentation of peptide antigen via MHC class I
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005790 C smooth endoplasmic reticulum
GO:0005791 C rough endoplasmic reticulum
GO:0005829 C cytosol
GO:0005840 C ribosome
GO:0006457 P protein folding
GO:0007568 P aging
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030246 F carbohydrate binding
GO:0030424 C axon
GO:0032839 C dendrite cytoplasm
GO:0034185 F apolipoprotein binding
GO:0035255 F ionotropic glutamate receptor binding
GO:0042470 C melanosome
GO:0043025 C neuronal cell body
GO:0043197 C dendritic spine
GO:0043209 C myelin sheath
GO:0043234 C protein-containing complex
GO:0044233 C mitochondria-associated endoplasmic reticulum membrane
GO:0044822 F RNA binding
GO:0046872 F metal ion binding
GO:0048488 P synaptic vesicle endocytosis
GO:0051082 F unfolded protein binding
GO:0061077 P chaperone-mediated protein folding
GO:0070062 C extracellular exosome
GO:0071556 C integral component of lumenal side of endoplasmic reticulum membrane
GO:0072583 P clathrin-dependent endocytosis
RNA-seq EntryA_SariASG_c37235_g1_i2
Sequence
(Amino Acid)
MQEGQKCGGAYIKLLSHGFETKADLLEFYDQSPYMIMFGPDKCGNSNDLHFIYRYKSTQA
NEAVEKKYSKKISRGLDFYNDKESHMYTLIIRPNNTYTIMIDNKLVVHESAFLEEFAPQG
DRPFQMAPIVSIHQ
*(44 a.a.)

- SilkBase 1999-2023 -