SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG13089_3prime_partial:A_SariASG_c37197_g1_i3
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_LOW_QUALITY_PROTEIN:_focal_adhesion_kinase_1_[Papilio_machaon]
Ontology
GO:0000165 P MAPK cascade
GO:0000166 F nucleotide binding
GO:0001525 P angiogenesis
GO:0001934 P positive regulation of protein phosphorylation
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004715 F non-membrane spanning protein tyrosine kinase activity
GO:0004871 F obsolete signal transducer activity
GO:0005178 F integrin binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005815 C microtubule organizing center
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005925 C focal adhesion
GO:0006468 P protein phosphorylation
GO:0007010 P cytoskeleton organization
GO:0007172 P signal complex assembly
GO:0007173 P epidermal growth factor receptor signaling pathway
GO:0007229 P integrin-mediated signaling pathway
GO:0007254 P JNK cascade
GO:0007275 P multicellular organism development
GO:0008284 P positive regulation of cell population proliferation
GO:0008360 P regulation of cell shape
GO:0009612 P response to mechanical stimulus
GO:0009749 P response to glucose
GO:0010033 P response to organic substance
GO:0010243 P response to organonitrogen compound
GO:0014068 P positive regulation of phosphatidylinositol 3-kinase signaling
GO:0014070 P response to organic cyclic compound
GO:0014704 C intercalated disc
GO:0014911 P positive regulation of smooth muscle cell migration
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016323 C basolateral plasma membrane
GO:0016324 C apical plasma membrane
GO:0016604 C nuclear body
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0030054 C cell junction
GO:0030307 P positive regulation of cell growth
GO:0030335 P positive regulation of cell migration
GO:0030336 P negative regulation of cell migration
GO:0030644 P cellular chloride ion homeostasis
GO:0031234 C extrinsic component of cytoplasmic side of plasma membrane
GO:0032355 P response to estradiol
GO:0032403 F protein-containing complex binding
GO:0033628 P regulation of cell adhesion mediated by integrin
GO:0038083 P peptidyl-tyrosine autophosphorylation
GO:0042127 P regulation of cell population proliferation
GO:0042383 C sarcolemma
GO:0042493 P response to xenobiotic stimulus
GO:0042802 F identical protein binding
GO:0043066 P negative regulation of apoptotic process
GO:0043548 F phosphatidylinositol 3-kinase binding
GO:0045087 P innate immune response
GO:0045444 P fat cell differentiation
GO:0045667 P regulation of osteoblast differentiation
GO:0045785 P positive regulation of cell adhesion
GO:0045860 P positive regulation of protein kinase activity
GO:0045909 P vasodilation
GO:0046685 P response to arsenic-containing substance
GO:0046777 P protein autophosphorylation
GO:0048013 P ephrin receptor signaling pathway
GO:0048471 C perinuclear region of cytoplasm
GO:0048661 P positive regulation of smooth muscle cell proliferation
GO:0050766 P positive regulation of phagocytosis
GO:0050806 P positive regulation of synaptic transmission
GO:0051897 P positive regulation of protein kinase B signaling
GO:0060252 P positive regulation of glial cell proliferation
GO:2000060 P positive regulation of ubiquitin-dependent protein catabolic process
RNA-seq EntryA_SariASG_c37197_g1_i3
Sequence
(Amino Acid)
MQPAPPGGSPKRHHATTPAHGAAADQSTLKVHLPNGGFNVVRASADEDVRSVLRLLAARL
ATGERVYAACYALRARRLTTGKTRWIHQDTPVSELLAKWPASEWRLELRVRYLPANLRDL
CDSDRVTFHYYYDQVRHDYLNANHPMVDQDLAIQICCLEIKYFCKDMQISLDKKSNIEYL
EKEFGLHKFLPKSVLESIKPKVLKKAIQQQFKKVANLSDTECMLKYLETMHTHYGYDREN
FTGVLGTGWAIPVELAIGPDIDMSYVSHKAGEPPTYIKIASFSDIVAVQTLKSNCTQQSQ
TQSGSCGKAALQLRVKGEIGRA
(106 a.a.)

- SilkBase 1999-2023 -