SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG13034_3prime_partial:A_SariASG_c37149_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
zinc_finger_protein_GLI4_isoform_X2_[Helicoverpa_armigera]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000980 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001205 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0002385 P mucosal immune response
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0007224 P smoothened signaling pathway
GO:0007275 P multicellular organism development
GO:0007346 P regulation of mitotic cell cycle
GO:0007350 P blastoderm segmentation
GO:0007367 P segment polarity determination
GO:0008544 P epidermis development
GO:0016020 C membrane
GO:0030707 P ovarian follicle cell development
GO:0030858 P positive regulation of epithelial cell differentiation
GO:0035017 P cuticle pattern formation
GO:0035217 P labial disc development
GO:0035224 P genital disc anterior/posterior pattern formation
GO:0035277 P spiracle morphogenesis, open tracheal system
GO:0035301 C Hedgehog signaling complex
GO:0042803 F protein homodimerization activity
GO:0043234 C protein-containing complex
GO:0044212 F transcription cis-regulatory region binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0048100 P wing disc anterior/posterior pattern formation
GO:0048477 P oogenesis
GO:0048592 P eye morphogenesis
GO:0048666 P neuron development
GO:0048813 P dendrite morphogenesis
GO:0060914 P heart formation
GO:1900087 P positive regulation of G1/S transition of mitotic cell cycle
RNA-seq EntryA_SariASG_c37149_g1_i2
Sequence
(Amino Acid)
MPDRESVGGPGSAGSGGFLPLQFPSAFAAFHASTPPGAPTSAMHHATHYHHHAQLAAAAA
AAAGATSELSYLAALHPAYRPVPYDHPIYGANTLRGLEYLSAARSLHPELHAGSTLASQD
FQLSLDGSRIASPTRLRLSGGTIGASANRKRAVSWSPYSAESLDLAAVIRASPASLAVRA
PSAASTGSYGHLSAGAISPALSLSHASLAQQLLARG
(71 a.a.)

- SilkBase 1999-2023 -