SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG12927_5prime_partial:A_SariASG_c37094_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
uncharacterized_protein_LOC110381391_[Helicoverpa_armigera]
Ontology
GO:0000164 C protein phosphatase type 1 complex
GO:0001934 P positive regulation of protein phosphorylation
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005741 C mitochondrial outer membrane
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0006417 P regulation of translation
GO:0006915 P apoptotic process
GO:0007568 P aging
GO:0008157 F protein phosphatase 1 binding
GO:0008285 P negative regulation of cell population proliferation
GO:0010628 P positive regulation of gene expression
GO:0010801 P negative regulation of peptidyl-threonine phosphorylation
GO:0010955 P negative regulation of protein processing
GO:0014070 P response to organic cyclic compound
GO:0016020 C membrane
GO:0019888 F protein phosphatase regulator activity
GO:0019901 F protein kinase binding
GO:0019903 F protein phosphatase binding
GO:0030968 P endoplasmic reticulum unfolded protein response
GO:0032515 P negative regulation of phosphoprotein phosphatase activity
GO:0032516 P positive regulation of phosphoprotein phosphatase activity
GO:0033138 P positive regulation of peptidyl-serine phosphorylation
GO:0034644 P cellular response to UV
GO:0034976 P response to endoplasmic reticulum stress
GO:0035308 P negative regulation of protein dephosphorylation
GO:0035690 P cellular response to xenobiotic stimulus
GO:0035902 P response to immobilization stress
GO:0036496 P regulation of translational initiation by eIF2 alpha dephosphorylation
GO:0042220 P response to cocaine
GO:0043065 P positive regulation of apoptotic process
GO:0045765 P regulation of angiogenesis
GO:0045943 P positive regulation of transcription by RNA polymerase I
GO:0060548 P negative regulation of cell death
GO:0060734 P regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation
GO:0070262 P peptidyl-serine dephosphorylation
GO:0070972 P protein localization to endoplasmic reticulum
GO:0071236 P cellular response to antibiotic
GO:0071322 P cellular response to carbohydrate stimulus
GO:0071407 P cellular response to organic cyclic compound
GO:0072703 P cellular response to methyl methanesulfonate
GO:0072732 P cellular response to calcium ion starvation
GO:0090648 P response to environmental enrichment
GO:0090650 P cellular response to oxygen-glucose deprivation
GO:1902310 P positive regulation of peptidyl-serine dephosphorylation
GO:1903573 P negative regulation of response to endoplasmic reticulum stress
GO:1903912 P negative regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation
GO:1903917 P positive regulation of endoplasmic reticulum stress-induced eIF2 alpha dephosphorylation
GO:1904308 P cellular response to desipramine
GO:1904310 P cellular response to cordycepin
GO:1904312 P cellular response to gold(3+)
GO:1904314 P cellular response to methamphetamine hydrochloride
GO:1990441 P negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress
RNA-seq EntryA_SariASG_c37094_g1_i1
Sequence
(Amino Acid)
VLFRSVEDCFEDALSIEECFCLPENSYIEYFSPPQYQKQELYEADAPKTKVEGKLMSESI
TSYDNSPKLVLEDLKLDYVTENNKLIESCEDKMAKLKAFLQQKCKNKTKSLLETGYTDSS
QLKPTKSIPIANSNNKRYKNPKSLCSKRVKTNMKQIIEDEMMFANEVNLDDFSSVEDSPS
FHSLEKWSESPQSNDTPHDYFDEISGRFQTGSAASSNDSFQIVFSDVPQRCRTTSDCDSE
DSFIVFEDSPDSCYTSNDVFCDSDDGSDSDSDMSDSGCGNMKLSQSLSRTVSNLTDDSLY
DEIDSVNNVQSSVVLNKEESGLLLDESKKSSKKEFPVKRVHFSPQPPKVHVMHVWAFAAR
QARAGHWEQYALDRERFRRRIADIDLALEWVLRPQHRSRIMFQRFMPWWNAQKRNELAEE
KEKEEAEKARRKTAEAELKETVIIEEIIEETQENNKEHGNEETLEELQDKKLKSDNAGYD
NFKLEEDSKQREIIANNTNNSLDEGIERCKRERKTKAYKNTQGVNQNLDANLENKLVHDQ
DRDEHGIDVVRDEDKRILKSNGI
*(187 a.a.)

- SilkBase 1999-2023 -