SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG12814_internal:A_SariASG_c37015_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_centromere/kinetochore_protein_zw10-like_[Amyelois_transitella]
Ontology
GO:0000070 P mitotic sister chromatid segregation
GO:0000132 P establishment of mitotic spindle orientation
GO:0000775 C chromosome, centromeric region
GO:0000776 C kinetochore
GO:0000777 C kinetochore
GO:0000922 C spindle pole
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005819 C spindle
GO:0005828 C kinetochore microtubule
GO:0005856 C cytoskeleton
GO:0006461 P protein-containing complex assembly
GO:0006810 P transport
GO:0006888 P endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0007030 P Golgi organization
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0007080 P mitotic metaphase plate congression
GO:0007093 P mitotic cell cycle checkpoint signaling
GO:0007094 P mitotic spindle assembly checkpoint signaling
GO:0007096 P regulation of exit from mitosis
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016192 P vesicle-mediated transport
GO:0034501 P protein localization to kinetochore
GO:0051301 P cell division
GO:0070939 C Dsl1/NZR complex
GO:1990423 C RZZ complex
RNA-seq EntryA_SariASG_c37015_g1_i1
Sequence
(Amino Acid)
FNKVIEDCIRNNLPSCDSSYEHYKNIVIELEAFNKFLIDLKFVDIEKSPLNKYIDDTECV
LYNKKCEKLLSDVRNLLTHSLSCGTVDVGIQSNNNKDTVLDVNDKDITWDLNKPIFLPKC
TVSSNVKTIMFMITEHLEESAKLPEIYNKKLVTYIKDIAVLYQCVVPKKFKVNLESCPSD
IALFFNNCFYLAHGLIGPPWCNILPRPLADQLILVLLECIQDLRMLGLEKISFYLQSQKN
TITQSIESEDSSWNRETYEYLDCSINTATTLMKDLKASWLHVLPMNMYEMSMC
(96 a.a.)

- SilkBase 1999-2023 -