Name | O_SariASG1278_3prime_partial:A_SariASG_c12249_g1_i1 |
Scaffold_id | |
NCBI non-redundant (nr) | PREDICTED:_PDZ_and_LIM_domain_protein_Zasp-like_isoform_X2_[Papilio_polytes] |
Ontology |
GO:0001725 |
C |
stress fiber |
GO:0001952 |
P |
regulation of cell-matrix adhesion |
GO:0003779 |
F |
actin binding |
GO:0005515 |
F |
protein binding |
GO:0005737 |
C |
cytoplasm |
GO:0005856 |
C |
cytoskeleton |
GO:0005915 |
C |
zonula adherens |
GO:0005925 |
C |
focal adhesion |
GO:0005927 |
C |
muscle tendon junction |
GO:0008270 |
F |
zinc ion binding |
GO:0015629 |
C |
actin cytoskeleton |
GO:0016323 |
C |
basolateral plasma membrane |
GO:0030018 |
C |
Z disc |
GO:0030239 |
P |
myofibril assembly |
GO:0031252 |
C |
cell leading edge |
GO:0045177 |
C |
apical part of cell |
GO:0045178 |
C |
basal part of cell |
GO:0046872 |
F |
metal ion binding |
GO:0051371 |
F |
muscle alpha-actinin binding |
GO:0061061 |
P |
muscle structure development |
|
RNA-seq Entry | A_SariASG_c12249_g1_i1 |
Sequence (Amino Acid) | MATGPKIVHKQFNSPIGLYSQQNIKETLNKHLHHLDNGSVGIDFNNPTTDKPANLANSAV
LRMLEEEERNRKGYPSQKKVVWPPVPETNGYHQTPQAPGTQPSYQQ
(34 a.a.) |