SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG12739_5prime_partial:A_SariASG_c36971_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
transcription_factor_Dp-1_isoform_X1_[Bombyx_mori]
Ontology
GO:0000278 P mitotic cell cycle
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003713 F transcription coactivator activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005667 C transcription regulator complex
GO:0005739 C mitochondrion
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006977 P DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
GO:0007049 P cell cycle
GO:0008134 F transcription factor binding
GO:0008283 P cell population proliferation
GO:0019904 F protein domain specific binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0070345 P negative regulation of fat cell proliferation
GO:1900740 P positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway
RNA-seq EntryA_SariASG_c36971_g1_i2
Sequence
(Amino Acid)
LFQIHDDIDILKRMGLLFGLDKGECSEEDIEKAKSMVPKSLESYVEQMGRGVISKLSTIL
QEEELDEETVDEEVIEDAEGEVEDEQEGEVNEYSDDSSDVDV
*(33 a.a.)

- SilkBase 1999-2023 -