SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG12679_3prime_partial:A_SariASG_c36940_g1_i3
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_probable_ubiquitin_carboxyl-terminal_hydrolase_FAF-X_isoform_X3_[Amyelois_transitella]
Ontology
GO:0001701 P in utero embryonic development
GO:0001764 P neuron migration
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0006508 P proteolysis
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0007049 P cell cycle
GO:0007059 P chromosome segregation
GO:0007067 P mitotic cell cycle
GO:0007179 P transforming growth factor beta receptor signaling pathway
GO:0008233 F peptidase activity
GO:0008234 F cysteine-type peptidase activity
GO:0009791 P post-embryonic development
GO:0016020 C membrane
GO:0016579 P protein deubiquitination
GO:0016787 F hydrolase activity
GO:0021698 P cerebellar cortex structural organization
GO:0021766 P hippocampus development
GO:0030426 C growth cone
GO:0030509 P BMP signaling pathway
GO:0036459 F thiol-dependent deubiquitinase
GO:0042995 C cell projection
GO:0045177 C apical part of cell
GO:0048675 P axon extension
GO:0051301 P cell division
GO:0070410 F co-SMAD binding
GO:0071560 P cellular response to transforming growth factor beta stimulus
GO:1990138 P neuron projection extension
RNA-seq EntryA_SariASG_c36940_g1_i3
Sequence
(Amino Acid)
MHIYFLLSFIFRQDILCQHLRCSQTVRAWFATDLFLHPHRLSEYLLSCPSAEVRLVFMKI
IMFLAHFSIQDPPVTEGYGSWCALDEATSLSDQVICSARALAAPPHSDAHAHRHLPLLFN
LFHTYALLGLSEKHQLLR
(45 a.a.)

- SilkBase 1999-2023 -