| Name | O_SariASG1260_internal:A_SariASG_c12019_g1_i1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | gamma-butyrobetaine_dioxygenase_[Bombyx_mori] |
| Ontology |
| GO:0005506 |
F |
iron ion binding |
| GO:0005739 |
C |
mitochondrion |
| GO:0005759 |
C |
mitochondrial matrix |
| GO:0016491 |
F |
oxidoreductase activity |
| GO:0016702 |
F |
oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen |
| GO:0031418 |
F |
L-ascorbic acid binding |
| GO:0045329 |
P |
carnitine biosynthetic process |
| GO:0046872 |
F |
metal ion binding |
| GO:0050353 |
F |
trimethyllysine dioxygenase activity |
| GO:0051213 |
F |
dioxygenase activity |
| GO:0051354 |
P |
negative regulation of oxidoreductase activity |
| GO:0055114 |
P |
obsolete oxidation-reduction process |
|
| RNA-seq Entry | A_SariASG_c12019_g1_i1 |
Sequence
(Amino Acid) | LHSSGTLQKFVKDNHLNLFIKGQSLKFPFVWLRDNCRCEQCFHRTAKSRILDWSKFDLNI
KPQDVVENENELQITWIDGHKSQYKYDWLMFRSFNSENQKNYNETIYEPKKIPWHGDDFT
(39 a.a.) |
