SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG12584_5prime_partial:A_SariASG_c36881_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
HSP90,_partial_[Mus_sp.]
Ontology
GO:0000166 F nucleotide binding
GO:0001890 P placenta development
GO:0001948 F protein binding
GO:0002134 F UTP binding
GO:0002135 F CTP binding
GO:0003725 F double-stranded RNA binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005525 F GTP binding
GO:0005622 C intracellular anatomical structure
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005765 C lysosomal membrane
GO:0005829 C cytosol
GO:0006457 P protein folding
GO:0006950 P response to stress
GO:0006986 P response to unfolded protein
GO:0008144 F obsolete drug binding
GO:0008180 C COP9 signalosome
GO:0009651 P response to salt stress
GO:0009986 C cell surface
GO:0010033 P response to organic substance
GO:0016020 C membrane
GO:0016234 C inclusion body
GO:0016323 C basolateral plasma membrane
GO:0016324 C apical plasma membrane
GO:0017098 F sulfonylurea receptor binding
GO:0019062 P virion attachment to host cell
GO:0019887 F protein kinase regulator activity
GO:0019900 F kinase binding
GO:0019901 F protein kinase binding
GO:0023026 F MHC class II protein complex binding
GO:0031396 P regulation of protein ubiquitination
GO:0031526 C brush border membrane
GO:0032092 P positive regulation of protein binding
GO:0032435 P negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032564 F dATP binding
GO:0033160 P obsolete positive regulation of protein import into nucleus, translocation
GO:0035690 P cellular response to xenobiotic stimulus
GO:0042220 P response to cocaine
GO:0042470 C melanosome
GO:0042493 P response to xenobiotic stimulus
GO:0042826 F histone deacetylase binding
GO:0043066 P negative regulation of apoptotic process
GO:0043524 P negative regulation of neuron apoptotic process
GO:0044325 F transmembrane transporter binding
GO:0044822 F RNA binding
GO:0045793 P positive regulation of cell size
GO:0051082 F unfolded protein binding
GO:0060334 P regulation of interferon-gamma-mediated signaling pathway
GO:0060338 P regulation of type I interferon-mediated signaling pathway
GO:0061635 P regulation of protein complex stability
GO:0061684 P chaperone-mediated autophagy
GO:0061741 P obsolete chaperone-mediated protein transport involved in chaperone-mediated autophagy
GO:0070062 C extracellular exosome
GO:0071353 P cellular response to interleukin-4
GO:0071407 P cellular response to organic cyclic compound
GO:0071902 P positive regulation of protein serine/threonine kinase activity
GO:0097435 P supramolecular fiber organization
GO:1903660 P negative regulation of complement-dependent cytotoxicity
GO:1990913 C sperm head plasma membrane
GO:1990917 C ooplasm
RNA-seq EntryA_SariASG_c36881_g1_i1
Sequence
(Amino Acid)
KKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTANMERIMKAQ
ALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFETALLSSGFS
LEDPQTHSNRIYRMIKLGLGIDEDEVTAEEPSAAVPDEIPPLEGDEDASRMEEVD
*(57 a.a.)

- SilkBase 1999-2023 -