SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG12524_5prime_partial:A_SariASG_c36837_g1_i3
Scaffold_id
NCBI non-redundant
(nr)		putative_zinc_finger_protein_91-like_protein_[Operophtera_brumata]
Ontology
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0010628 P positive regulation of gene expression
GO:0010629 P negative regulation of gene expression
GO:0022612 P gland morphogenesis
GO:0035264 P multicellular organism growth
GO:0035265 P organ growth
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0060252 P positive regulation of glial cell proliferation
GO:0060736 P prostate gland growth
RNA-seq EntryA_SariASG_c36837_g1_i3
Sequence
(Amino Acid)
LFRSPRPFKCIQKDCDRSFVTKHSLSVHMAHTHTSERPHKCDICYKAFATASGLKTHRDS
HINKDIYCTICGKRVANKRVLQKHIKMHEVNADDMILETVVDNVFFNEPMI
*(36 a.a.)

- SilkBase 1999-2023 -