SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG1249_internal:A_SariASG_c11785_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
matrix_metalloproteinase-14-like_[Helicoverpa_armigera]
Ontology
GO:0002218 P activation of innate immune response
GO:0004175 F endopeptidase activity
GO:0004222 F metalloendopeptidase activity
GO:0005886 C plasma membrane
GO:0006508 P proteolysis
GO:0007424 P open tracheal system development
GO:0007426 P tracheal outgrowth, open tracheal system
GO:0007505 P adult fat body development
GO:0007561 P imaginal disc eversion
GO:0008045 P motor neuron axon guidance
GO:0008233 F peptidase activity
GO:0008237 F metallopeptidase activity
GO:0008270 F zinc ion binding
GO:0009897 C external side of plasma membrane
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016485 P protein processing
GO:0016787 F hydrolase activity
GO:0030178 P negative regulation of Wnt signaling pathway
GO:0030425 C dendrite
GO:0030728 P ovulation
GO:0031012 C extracellular matrix
GO:0034769 P basement membrane disassembly
GO:0035202 P tracheal pit formation in open tracheal system
GO:0040037 P negative regulation of fibroblast growth factor receptor signaling pathway
GO:0042060 P wound healing
GO:0045216 P cell-cell junction organization
GO:0046331 P lateral inhibition
GO:0046529 P imaginal disc fusion, thorax closure
GO:0046872 F metal ion binding
GO:0048477 P oogenesis
GO:0071711 P basement membrane organization
GO:0090090 P negative regulation of canonical Wnt signaling pathway
GO:0097156 P fasciculation of motor neuron axon
RNA-seq EntryA_SariASG_c11785_g1_i1
Sequence
(Amino Acid)
GTGRGGDAHFDDDELWLLHPNNDEEEGTSLFAVAAHEFGHSLGLSHSSVKGALMFPWYQG
IQPNFVLPEDDRNGIQQMYGPKVNNKPWARIPYYPVEAPTTTTTTTSTTTTTRRPHIHHH
NRHYDKYPHRPEYTPYPRDPTRYPTYYPKKPYYPPERPYYPERRHYNTSEEHPRRNYQIG
RA
(59 a.a.)

- SilkBase 1999-2023 -