SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG1246_internal:A_SariASG_c11747_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		Solute_carrier_family_22_member_13_[Papilio_xuthus]
Ontology
GO:0005215 F transporter activity
GO:0005329 F dopamine:sodium symporter activity
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006855 P xenobiotic transmembrane transport
GO:0015101 F organic cation transmembrane transporter activity
GO:0015651 F quaternary ammonium group transmembrane transporter activity
GO:0015695 P organic cation transport
GO:0015697 P quaternary ammonium group transport
GO:0015844 P monoamine transport
GO:0015872 P dopamine transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0019534 F toxin transmembrane transporter activity
GO:0032098 P regulation of appetite
GO:0051608 P histamine transport
GO:0051615 P histamine uptake
GO:0055085 P transmembrane transport
GO:0072488 P ammonium transmembrane transport
GO:0098779 P positive regulation of mitophagy in response to mitochondrial depolarization
GO:1901998 P toxin transport
RNA-seq EntryA_SariASG_c11747_g1_i2
Sequence
(Amino Acid)
WLVSKGQTDKAIEVLTRIAKFNKQNISEIETNVKYAARNITEKIITEPNYLDFLKFKFNT
LAITIIWISGGACFYGINQYITFMGDNSLITVVLLGLIQVSLKSISSERTDRKS
(37 a.a.)

- SilkBase 1999-2023 -