SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG12412_3prime_partial:A_SariASG_c36791_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
putative_che-11,_partial_[Operophtera_brumata]
Ontology
GO:0001750 C photoreceptor outer segment
GO:0003674 F molecular_function
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005856 C cytoskeleton
GO:0005929 C cilium
GO:0005930 C axoneme
GO:0007368 P determination of left/right symmetry
GO:0007507 P heart development
GO:0008589 P regulation of smoothened signaling pathway
GO:0021532 P neural tube patterning
GO:0030030 P cell projection organization
GO:0030991 C intraciliary transport particle A
GO:0031513 C non-motile cilium
GO:0032391 C photoreceptor connecting cilium
GO:0035108 P limb morphogenesis
GO:0035721 P intraciliary retrograde transport
GO:0035845 P photoreceptor cell outer segment organization
GO:0036064 C ciliary basal body
GO:0042073 P intraciliary transport
GO:0042384 P cilium assembly
GO:0042995 C cell projection
GO:0048705 P skeletal system morphogenesis
GO:0060041 P retina development in camera-type eye
GO:0060271 P cilium assembly
GO:0061512 P protein localization to cilium
GO:0072001 P renal system development
GO:0072372 C cilium
GO:0097542 C ciliary tip
GO:1902017 P regulation of cilium assembly
RNA-seq EntryA_SariASG_c36791_g1_i1
Sequence
(Amino Acid)
MTLYIDTKLNFSNGNVVSTLGSWHPSLPLLAVGSYNQEKGGFVTIFHETGLPLEGCEWPV
LVSNQVTALAWHPTRRLLVVGWDGGELYIWLEYSWARLEAPHNASLTSIAFSHGGGRLLA
SDAAGSLSGWQSGSGAPLTSFHHQLGDVITNITFCTPRPNTESSIRGLVRAAV
(56 a.a.)

- SilkBase 1999-2023 -