SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG1233_internal:A_SariASG_c11563_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		rCG57965,_isoform_CRA_c_[Rattus_norvegicus]
Ontology
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0000166 F nucleotide binding
GO:0000974 C Prp19 complex
GO:0001822 P kidney development
GO:0001916 P positive regulation of T cell mediated cytotoxicity
GO:0001917 C photoreceptor inner segment
GO:0003723 F RNA binding
GO:0005102 F signaling receptor binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005681 C spliceosomal complex
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005776 C autophagosome
GO:0005829 C cytosol
GO:0005874 C microtubule
GO:0005882 C intermediate filament
GO:0005886 C plasma membrane
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006397 P mRNA processing
GO:0006606 P protein import into nucleus
GO:0007519 P skeletal muscle tissue development
GO:0007568 P aging
GO:0007608 P sensory perception of smell
GO:0008021 C synaptic vesicle
GO:0008088 P axo-dendritic transport
GO:0008134 F transcription factor binding
GO:0008380 P RNA splicing
GO:0009408 P response to heat
GO:0009986 C cell surface
GO:0010045 P response to nickel cation
GO:0010628 P positive regulation of gene expression
GO:0010667 P negative regulation of cardiac muscle cell apoptotic process
GO:0014069 C postsynaptic density
GO:0014823 P response to activity
GO:0016020 C membrane
GO:0016887 F ATP hydrolysis activity
GO:0019899 F enzyme binding
GO:0021549 P cerebellum development
GO:0030424 C axon
GO:0030425 C dendrite
GO:0030529 C ribonucleoprotein complex
GO:0030900 P forebrain development
GO:0031686 F A1 adenosine receptor binding
GO:0032279 C asymmetric synapse
GO:0032355 P response to estradiol
GO:0032570 P response to progesterone
GO:0034605 P cellular response to heat
GO:0042026 P protein refolding
GO:0042277 F peptide binding
GO:0042470 C melanosome
GO:0042493 P response to xenobiotic stimulus
GO:0042594 P response to starvation
GO:0042623 F ATP hydrolysis activity
GO:0043005 C neuron projection
GO:0043025 C neuronal cell body
GO:0043085 P positive regulation of catalytic activity
GO:0043195 C terminal bouton
GO:0043197 C dendritic spine
GO:0043198 C dendritic shaft
GO:0043204 C perikaryon
GO:0043234 C protein-containing complex
GO:0043531 F ADP binding
GO:0043624 P protein-containing complex disassembly
GO:0044743 P protein transmembrane import into intracellular organelle
GO:0044849 P estrous cycle
GO:0045121 C membrane raft
GO:0045471 P response to ethanol
GO:0045862 P positive regulation of proteolysis
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046777 P protein autophosphorylation
GO:0048471 C perinuclear region of cytoplasm
GO:0050766 P positive regulation of phagocytosis
GO:0051082 F unfolded protein binding
GO:0051085 P chaperone cofactor-dependent protein refolding
GO:0061077 P chaperone-mediated protein folding
GO:0061635 P regulation of protein complex stability
GO:0061684 P chaperone-mediated autophagy
GO:0061741 P obsolete chaperone-mediated protein transport involved in chaperone-mediated autophagy
GO:0070062 C extracellular exosome
GO:0071276 P cellular response to cadmium ion
GO:0072318 P clathrin coat disassembly
GO:0097214 P positive regulation of lysosomal membrane permeability
GO:1903206 P negative regulation of hydrogen peroxide-induced cell death
GO:1904592 P positive regulation of protein refolding
GO:1904593 F prostaglandin binding
GO:1904764 P chaperone-mediated autophagy translocation complex disassembly
GO:1990124 C messenger ribonucleoprotein complex
GO:1990832 P slow axonal transport
GO:1990833 F clathrin-uncoating ATPase activity
GO:1990834 P response to odorant
GO:1990836 C lysosomal matrix
RNA-seq EntryA_SariASG_c11563_g1_i1
Sequence
(Amino Acid)
ENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEK
LQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKE
(32 a.a.)

- SilkBase 1999-2023 -