SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG12179_internal:A_SariASG_c36687_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		alcohol_dehydrogenase_12,_partial_[Helicoverpa_armigera]
Ontology
GO:0003939 F L-iditol 2-dehydrogenase activity
GO:0005615 C extracellular space
GO:0005739 C mitochondrion
GO:0005829 C cytosol
GO:0005929 C cilium
GO:0006006 P glucose metabolic process
GO:0006060 P sorbitol metabolic process
GO:0006062 P sorbitol catabolic process
GO:0006970 P response to osmotic stress
GO:0008270 F zinc ion binding
GO:0009725 P response to hormone
GO:0016020 C membrane
GO:0016491 F oxidoreductase activity
GO:0019640 P glucuronate catabolic process to xylulose 5-phosphate
GO:0030246 F carbohydrate binding
GO:0030317 P flagellated sperm motility
GO:0031514 C motile cilium
GO:0031667 P response to nutrient levels
GO:0031966 C mitochondrial membrane
GO:0042493 P response to xenobiotic stimulus
GO:0042802 F identical protein binding
GO:0042995 C cell projection
GO:0046370 P fructose biosynthetic process
GO:0046526 F D-xylulose reductase activity
GO:0046686 P response to cadmium ion
GO:0046688 P response to copper ion
GO:0046872 F metal ion binding
GO:0051160 P L-xylitol catabolic process
GO:0051164 P L-xylitol metabolic process
GO:0051287 F NAD binding
GO:0055114 P obsolete oxidation-reduction process
GO:0070062 C extracellular exosome
RNA-seq EntryA_SariASG_c36687_g1_i2
Sequence
(Amino Acid)
SRRTRTFKMSTDNLTALLYKPKDLQLVQTPIPEINDDEVLLRMDCVGICGSDVHYWQTGA
CGHFVLKEPMIMGHEASGVVAKLGGKVKSLKVGDRVAIEPGVPCRYCEFCKTGRYHLCPD
MSFCATPPVHGNLVRYYKHAADFCFKLPDHVSMEEGALLEPLSVGIHACRRGGVSAGHVV
LVLGAGPIGLLTMLAAKAFGASKVLITDILQSRLDFAQELGADHTLLVTRESNEA
(77 a.a.)

- SilkBase 1999-2023 -