SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG1210_internal:A_SariASG_c11296_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
fat-like_cadherin-related_tumor_suppressor_homolog,_partial_[Helicoverpa_armigera]
Ontology
GO:0003674 F molecular_function
GO:0004872 F signaling receptor activity
GO:0005509 F calcium ion binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005925 C focal adhesion
GO:0007155 P cell adhesion
GO:0007156 P homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007293 P germarium-derived egg chamber formation
GO:0007295 P growth of a germarium-derived egg chamber
GO:0007424 P open tracheal system development
GO:0007431 P salivary gland development
GO:0007440 P foregut morphogenesis
GO:0007442 P hindgut morphogenesis
GO:0009925 C basal plasma membrane
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016339 P calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0030950 P establishment or maintenance of actin cytoskeleton polarity
GO:0042247 P establishment of planar polarity of follicular epithelium
GO:0044331 P cell-cell adhesion mediated by cadherin
GO:0045089 P positive regulation of innate immune response
GO:0045571 P negative regulation of imaginal disc growth
GO:0048477 P oogenesis
GO:0050829 P defense response to Gram-negative bacterium
GO:0050839 F cell adhesion molecule binding
GO:0060429 P epithelium development
RNA-seq EntryA_SariASG_c11296_g1_i1
Sequence
(Amino Acid)
CSSDLRLPMAGARVRFRIRRGDRDKFFKAEERTVGDYCFLLVRTRTGHGDVLNRERRDLY
RLEVHATAHLPTGRRLEADATLLVTVADENDLSPLFYPT
(32 a.a.)

- SilkBase 1999-2023 -