SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG1209_5prime_partial:A_SariASG_c11291_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		60S_ribosomal_protein_L13a_isoform_X2_[Mus_pahari]
Ontology
GO:0003729 F mRNA binding
GO:0003735 F structural constituent of ribosome
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005840 C ribosome
GO:0005925 C focal adhesion
GO:0006412 P translation
GO:0006417 P regulation of translation
GO:0015934 C large ribosomal subunit
GO:0016020 C membrane
GO:0017148 P negative regulation of translation
GO:0022625 C cytosolic large ribosomal subunit
GO:0030529 C ribonucleoprotein complex
GO:0032496 P response to lipopolysaccharide
GO:0032844 P homeostatic process
GO:0044822 F RNA binding
GO:0048246 P macrophage chemotaxis
GO:0060425 P lung morphogenesis
GO:0071346 P cellular response to interferon-gamma
GO:0097452 C GAIT complex
GO:1901194 P negative regulation of formation of translation preinitiation complex
RNA-seq EntryA_SariASG_c11291_g1_i1
Sequence
(Amino Acid)
GQAALERLKVLDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTA
TLEEKRKEKAKMHYRKKKQILRLRKQAEKNVEKKICKFTEVLKTNGLLV
*(35 a.a.)

- SilkBase 1999-2023 -