SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG1200_5prime_partial:A_SariASG_c11146_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_CCR4-NOT_transcription_complex_subunit_1_[Plutella_xylostella]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000288 P nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:0000932 C P-body
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006417 P regulation of translation
GO:0010606 P positive regulation of cytoplasmic mRNA processing body assembly
GO:0017148 P negative regulation of translation
GO:0030014 C CCR4-NOT complex
GO:0030015 C CCR4-NOT core complex
GO:0030331 F estrogen receptor binding
GO:0031047 P gene silencing by RNA
GO:0032947 F molecular adaptor activity
GO:0033147 P negative regulation of intracellular estrogen receptor signaling pathway
GO:0042974 F retinoic acid receptor binding
GO:0048387 P negative regulation of retinoic acid receptor signaling pathway
GO:0048589 P developmental growth
GO:0060213 P positive regulation of nuclear-transcribed mRNA poly(A) tail shortening
GO:1900153 P positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
RNA-seq EntryA_SariASG_c11146_g1_i1
Sequence
(Amino Acid)
ERYLFLNAIANQLRYPNSHTHYFSCCLLYLFAEANSKAVQEQITRMLLERLIVNRPHPWG
LLITFIELIKNPVYKFWSHDFVHCAPEIEKLFASVARSCIADKSGGGGIEREIGE
*(37 a.a.)

- SilkBase 1999-2023 -