SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG1194_internal:A_SariASG_c11089_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		zinc_metalloprotease_[Danaus_plexippus_plexippus]
Ontology
GO:0001822 P kidney development
GO:0004222 F metalloendopeptidase activity
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005903 C brush border
GO:0006508 P proteolysis
GO:0006518 P peptide metabolic process
GO:0008021 C synaptic vesicle
GO:0008233 F peptidase activity
GO:0008237 F metallopeptidase activity
GO:0008270 F zinc ion binding
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016787 F hydrolase activity
GO:0019233 P sensory perception of pain
GO:0030424 C axon
GO:0030425 C dendrite
GO:0042277 F peptide binding
GO:0044306 C neuron projection terminus
GO:0045202 C synapse
GO:0046449 P creatinine metabolic process
GO:0046872 F metal ion binding
GO:0050435 P amyloid-beta metabolic process
GO:0071345 P cellular response to cytokine stimulus
GO:0071492 P cellular response to UV-A
GO:0071493 P cellular response to UV-B
GO:0090399 P replicative senescence
RNA-seq EntryA_SariASG_c11089_g1_i1
Sequence
(Amino Acid)
KLTEFYSGLEMSSDKLMESVLNLTLFGTEYLFGKLREPVNKTDWVTHGRPAIVNAFYSSI
ENSIQFPAGILQGAFFSAKRPAYMNYGAIGFVIGHEITHGDRK
(33 a.a.)

- SilkBase 1999-2023 -