SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG11930_5prime_partial:A_SariASG_c36506_g2_i1
Scaffold_id
NCBI non-redundant
(nr)		delta-aminolevulinic_acid_dehydratase_[Bombyx_mori]
Ontology
GO:0001666 P response to hypoxia
GO:0003824 F catalytic activity
GO:0004655 F porphobilinogen synthase activity
GO:0005615 C extracellular space
GO:0005634 C nucleus
GO:0005829 C cytosol
GO:0006779 P porphyrin-containing compound biosynthetic process
GO:0006782 P protoporphyrinogen IX biosynthetic process
GO:0006783 P heme biosynthetic process
GO:0006979 P response to oxidative stress
GO:0007584 P response to nutrient
GO:0008152 P metabolic process
GO:0008270 F zinc ion binding
GO:0009635 P response to herbicide
GO:0009636 P response to toxic substance
GO:0009725 P response to hormone
GO:0010033 P response to organic substance
GO:0010035 P response to inorganic substance
GO:0010038 P response to metal ion
GO:0010039 P response to iron ion
GO:0010043 P response to zinc ion
GO:0010044 P response to aluminum ion
GO:0010212 P response to ionizing radiation
GO:0010266 P response to vitamin B1
GO:0010269 P response to selenium ion
GO:0010288 P response to lead ion
GO:0014070 P response to organic cyclic compound
GO:0014823 P response to activity
GO:0016829 F lyase activity
GO:0031667 P response to nutrient levels
GO:0032025 P response to cobalt ion
GO:0032496 P response to lipopolysaccharide
GO:0032791 F lead ion binding
GO:0033014 P tetrapyrrole biosynthetic process
GO:0033197 P response to vitamin E
GO:0033273 P response to vitamin
GO:0042493 P response to xenobiotic stimulus
GO:0042802 F identical protein binding
GO:0043200 P response to amino acid
GO:0045471 P response to ethanol
GO:0046685 P response to arsenic-containing substance
GO:0046686 P response to cadmium ion
GO:0046689 P response to mercury ion
GO:0046872 F metal ion binding
GO:0051260 P protein homooligomerization
GO:0051384 P response to glucocorticoid
GO:0051597 P response to methylmercury
GO:0070062 C extracellular exosome
GO:0070541 P response to platinum ion
GO:0070542 P response to fatty acid
GO:0071284 P cellular response to lead ion
GO:0071353 P cellular response to interleukin-4
RNA-seq EntryA_SariASG_c36506_g2_i1
Sequence
(Amino Acid)
ENDDAIQAVSSMPNVFRYGIKQLLTVLSELVEKGLKSILIFGIIETLPKDPIGSNADSEE
NPVMRALPKLREAFPDLLIACDVCLCPYTSHGHCGVLTASGAIDHAASVKRIAEVSLAYA
IAGAQVIAPSDMMDNRIKAIKDSLVTVKLQNQVSVLSYSCKFASSMYGPFRDTMKSSPME
GDRKCYQLPPGSAGLAARAAARDVAEGADFLMVKPGLPYLDIVKQTKDQFPHHPLYIYQV
SGEYAMISHSGDAKEIQTTLMEILTCMRRAGADCIITYFAPLILNIISGKQ
*(96 a.a.)

- SilkBase 1999-2023 -