SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG11870_complete:A_SariASG_c36475_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		ring_canal_kelch_homolog_[Bombyx_mori]
Ontology
GO:0003779 F actin binding
GO:0004842 F ubiquitin-protein transferase activity
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005938 C cell cortex
GO:0007275 P multicellular organism development
GO:0007297 P ovarian follicle cell migration
GO:0007300 P ovarian nurse cell to oocyte transport
GO:0007301 P female germline ring canal formation
GO:0007303 P cytoplasmic transport, nurse cell to oocyte
GO:0007349 P cellularization
GO:0016567 P protein ubiquitination
GO:0030036 P actin cytoskeleton organization
GO:0030154 P cell differentiation
GO:0030717 P oocyte karyosome formation
GO:0030723 P ovarian fusome organization
GO:0031463 C Cul3-RING ubiquitin ligase complex
GO:0035183 C female germline ring canal inner rim
GO:0035324 C female germline ring canal
GO:0045172 C germline ring canal
GO:0048477 P oogenesis
RNA-seq EntryA_SariASG_c36475_g1_i1
Sequence
(Amino Acid)
MEGNAEGDRDRALLGVDNSAAEGDADGERGGRYSLMVRCASQSSLDESSQRPVGGEGAPA
SSHHATKLLDALAALRQDATLCDVQLQVSAACSRCTLAGQRSHLVGRL
*(35 a.a.)

- SilkBase 1999-2023 -