SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG1178_internal:A_SariASG_c10649_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_multidrug_resistance_protein_homolog_49-like_[Amyelois_transitella]
Ontology
GO:0000166 F nucleotide binding
GO:0005524 F ATP binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005919 C pleated septate junction
GO:0006810 P transport
GO:0006855 P xenobiotic transmembrane transport
GO:0008152 P metabolic process
GO:0008559 F ABC-type xenobiotic transporter activity
GO:0015562 F efflux transmembrane transporter activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016787 F hydrolase activity
GO:0016887 F ATP hydrolysis activity
GO:0031427 P response to methotrexate
GO:0042626 F ATPase-coupled transmembrane transporter activity
GO:0042908 P xenobiotic transport
GO:0043190 C ATP-binding cassette (ABC) transporter complex
GO:0055085 P transmembrane transport
GO:0060857 P establishment of glial blood-brain barrier
RNA-seq EntryA_SariASG_c10649_g1_i1
Sequence
(Amino Acid)
DVWLFRSVYSWKMTLVSLLSVPCVIGGIYLEGYVNKRAEVRERRALERASRVATEALLNV
RTVQSLGNYCHITQHPLHKLFSYFPSETPHTPIHLFFTRPDRKSV
(34 a.a.)

- SilkBase 1999-2023 -