SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG11743_complete:A_SariASG_c36397_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_mitogen-activated_protein_kinase_14B-like_isoform_X1_[Papilio_polytes]
Ontology
GO:0000165 P MAPK cascade
GO:0000166 F nucleotide binding
GO:0001934 P positive regulation of protein phosphorylation
GO:0003007 P heart morphogenesis
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004707 F MAP kinase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0006468 P protein phosphorylation
GO:0006952 P defense response
GO:0006955 P immune response
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007623 P circadian rhythm
GO:0008340 P determination of adult lifespan
GO:0009408 P response to heat
GO:0009617 P response to bacterium
GO:0009651 P response to salt stress
GO:0010906 P regulation of glucose metabolic process
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0016909 F MAP kinase activity
GO:0030510 P regulation of BMP signaling pathway
GO:0034614 P cellular response to reactive oxygen species
GO:0038001 P paracrine signaling
GO:0040018 P positive regulation of multicellular organism growth
GO:0042542 P response to hydrogen peroxide
GO:0042594 P response to starvation
GO:0042742 P defense response to bacterium
GO:0045088 P regulation of innate immune response
GO:0045793 P positive regulation of cell size
GO:0048082 P regulation of adult chitin-containing cuticle pigmentation
GO:0050832 P defense response to fungus
GO:0071243 P cellular response to arsenic-containing substance
GO:0071276 P cellular response to cadmium ion
GO:0072593 P reactive oxygen species metabolic process
GO:1900407 P regulation of cellular response to oxidative stress
GO:2000331 P regulation of terminal button organization
RNA-seq EntryA_SariASG_c36397_g1_i1
Sequence
(Amino Acid)
MPRFHKVEINKTEWIVPERYQMLTPVGSGAYGQVCSAIDTLHNMKVAIKKLARPFQSAVH
AKRTYRELRMLKHMNHENVIGLLDVFSPEKTLEEFQQVYLVTHLMGADLNNIIRTQKLSD
DHVQFLVYQILRGMKYIHSAGIIHRDLKPSNIAVNEDCELKILDFGLARPTETEMTGYVA
TRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGTPGH
EFMLKISSESARNYIQSLPTLKRRDFREVFRGANPLAVNLLELMLELDADKRITAEQALA
HEYLAQYADPTDEPVSAPYDQSFEDMELPVDKWKELVWKETVEFKPHPQHMNTVVEVNAS
*(119 a.a.)

- SilkBase 1999-2023 -