SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG11740_internal:A_SariASG_c36392_g1_i3
Scaffold_id
NCBI non-redundant
(nr)		LOW_QUALITY_PROTEIN:_notch-like_protein_isoform_X1_[Bombyx_mori]
Ontology
GO:0000186 P obsolete activation of MAPKK activity
GO:0000187 P obsolete activation of MAPK activity
GO:0001525 P angiogenesis
GO:0005154 F epidermal growth factor receptor binding
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0005765 C lysosomal membrane
GO:0005886 C plasma membrane
GO:0007173 P epidermal growth factor receptor signaling pathway
GO:0007262 P regulation of receptor signaling pathway via JAK-STAT
GO:0008083 F growth factor activity
GO:0008284 P positive regulation of cell population proliferation
GO:0010800 P positive regulation of peptidyl-threonine phosphorylation
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0017147 F Wnt-protein binding
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0021940 P positive regulation of cerebellar granule cell precursor proliferation
GO:0035413 P positive regulation of canonical Wnt signaling pathway
GO:0042327 P positive regulation of phosphorylation
GO:0042813 F Wnt-activated receptor activity
GO:0043235 C receptor complex
GO:0043388 P positive regulation of DNA binding
GO:0043406 P positive regulation of MAP kinase activity
GO:0044332 P Wnt signaling pathway involved in dorsal/ventral axis specification
GO:0045741 P positive regulation of epidermal growth factor-activated receptor activity
GO:0045840 P positive regulation of mitotic nuclear division
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0048754 P branching morphogenesis of an epithelial tube
GO:0050730 P regulation of peptidyl-tyrosine phosphorylation
GO:0050731 P positive regulation of peptidyl-tyrosine phosphorylation
GO:0051048 P negative regulation of secretion
GO:0051223 P regulation of protein transport
GO:0060070 P canonical Wnt signaling pathway
GO:0060749 P mammary gland alveolus development
GO:0070062 C extracellular exosome
GO:0070371 P ERK1 and ERK2 cascade
GO:0090279 P regulation of calcium ion import
GO:0090370 P negative regulation of cholesterol efflux
GO:1900127 P positive regulation of hyaluronan biosynthetic process
GO:2000008 P regulation of protein localization to cell surface
GO:2000060 P positive regulation of ubiquitin-dependent protein catabolic process
RNA-seq EntryA_SariASG_c36392_g1_i3
Sequence
(Amino Acid)
DRKSNSAPGYNCICPQGFRANPNPQIACEQVDVNILCKSNFDCTNNAECIENKCYCKEGF
DAKGSVCEDVDECAIKHSVCGENSLCINTPGGYNCECAA
(32 a.a.)

- SilkBase 1999-2023 -