| Name | O_SariASG1162_internal:A_SariASG_c10299_g1_i1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | LOW_QUALITY_PROTEIN:_obscurin_[Bombyx_mori] |
| Ontology |
| GO:0004672 |
F |
protein kinase activity |
| GO:0005089 |
F |
guanyl-nucleotide exchange factor activity |
| GO:0005524 |
F |
ATP binding |
| GO:0006468 |
P |
protein phosphorylation |
| GO:0016301 |
F |
kinase activity |
| GO:0016310 |
P |
phosphorylation |
| GO:0016740 |
F |
transferase activity |
| GO:0017048 |
F |
small GTPase binding |
| GO:0019902 |
F |
phosphatase binding |
| GO:0030241 |
P |
skeletal muscle myosin thick filament assembly |
| GO:0031034 |
P |
myosin filament assembly |
| GO:0031430 |
C |
M band |
| GO:0031672 |
C |
A band |
| GO:0035023 |
P |
regulation of Rho protein signal transduction |
| GO:0043547 |
P |
positive regulation of GTPase activity |
|
| RNA-seq Entry | A_SariASG_c10299_g1_i1 |
Sequence
(Amino Acid) | DGVPKPEVHWYLNGKEITSDERRTVTTEVGGQVDSELDIKHFNATDAGKYKVRAMNMAGE
AECEASVALAQTAPGFAHKLDRQREVDEGEPLELKAKLD
(32 a.a.) |
