SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG11574_complete:A_SariASG_c36283_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
transcriptional_coactivator_YAP1_isoform_X4_[Helicoverpa_armigera]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001649 P osteoblast differentiation
GO:0001933 P negative regulation of protein phosphorylation
GO:0003713 F transcription coactivator activity
GO:0003714 F transcription corepressor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005667 C transcription regulator complex
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006367 P transcription initiation from RNA polymerase II promoter
GO:0006469 P negative regulation of protein kinase activity
GO:0008284 P positive regulation of cell population proliferation
GO:0010718 P positive regulation of epithelial to mesenchymal transition
GO:0016567 P protein ubiquitination
GO:0017145 P stem cell division
GO:0031146 P SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0032835 P glomerulus development
GO:0035264 P multicellular organism growth
GO:0035329 P hippo signaling
GO:0035414 P negative regulation of canonical Wnt signaling pathway
GO:0042803 F protein homodimerization activity
GO:0045599 P negative regulation of fat cell differentiation
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048762 P mesenchymal cell differentiation
GO:0060271 P cilium assembly
GO:0060390 P regulation of SMAD protein signal transduction
GO:0060828 P regulation of canonical Wnt signaling pathway
GO:0060993 P kidney morphogenesis
GO:0072307 P regulation of metanephric nephron tubule epithelial cell differentiation
GO:0090090 P negative regulation of canonical Wnt signaling pathway
RNA-seq EntryA_SariASG_c36283_g1_i1
Sequence
(Amino Acid)
MALNSDAEQKSNLVLRVDQDSDSVLQSLFDTVLKPDSKRPLQVPLRMRQLPKSFFNPPST
GSKSPSVSHSRENSADSAFGSSSATGATPVSHSRAHSSPASLQQTYAAGQNQQPPLHHQH
SKQRSYDVGSHIPDDLGPLPAGWEQARTPEGQIYYLNHITKTTTWDDPRKTLAAQTVAGG
VQHQSAEALLTQSSPQPTIANTSPPAQHLQRTPVGSAGAAGGGWANASIQACQQKLRLQS
LQLERDRLKQRQQEIRLQQELMARQASSIVSSLVSSTGVVTSTDLPLDPFLSGLTDHQRQ
ESADSGLGMAVPQSYSMPHTPEGFLSMDDRMDCSSEAGANLDSTDITLGDNIDSTDDLVP
SLQLNEFTNDILLDDVQSLINSTPSKPDNVLTWL
*(130 a.a.)

- SilkBase 1999-2023 -