SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG1156_internal:A_SariASG_c10275_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
V-type_proton_ATPase_subunit_S1_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0005524 F ATP binding
GO:0005773 C vacuole
GO:0005774 C vacuolar membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0015991 P proton transmembrane transport
GO:0015992 P proton transmembrane transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0017137 F small GTPase binding
GO:0033180 C proton-transporting V-type ATPase, V1 domain
GO:0045669 P positive regulation of osteoblast differentiation
GO:0045780 P positive regulation of bone resorption
GO:0045851 P pH reduction
GO:0045921 P positive regulation of exocytosis
GO:0046933 F proton-transporting ATP synthase activity, rotational mechanism
GO:0046961 F proton-transporting ATPase activity, rotational mechanism
GO:0051656 P establishment of organelle localization
GO:0070062 C extracellular exosome
GO:0070374 P positive regulation of ERK1 and ERK2 cascade
GO:2001206 P positive regulation of osteoclast development
RNA-seq EntryA_SariASG_c10275_g1_i1
Sequence
(Amino Acid)
VEAILGFSYRCKQFVSFISVNETIEYKLTFKDIKVQPFFESTNDTMPFGDSFNCVGFFSA
PIWSGLFVVFILLAITFYGIMMMMDIRTMDRFDDPKGKTITINAGE
(34 a.a.)

- SilkBase 1999-2023 -