| Name | O_SariASG11514_complete:A_SariASG_c36245_g1_i1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | cysteine-rich_PDZ-binding_protein_[Helicoverpa_armigera] |
| Ontology |
| GO:0005634 |
C |
nucleus |
| GO:0005730 |
C |
nucleolus |
| GO:0005737 |
C |
cytoplasm |
| GO:0008017 |
F |
microtubule binding |
| GO:0014069 |
C |
postsynaptic density |
| GO:0030054 |
C |
cell junction |
| GO:0030165 |
F |
PDZ domain binding |
| GO:0030425 |
C |
dendrite |
| GO:0031122 |
P |
cytoplasmic microtubule organization |
| GO:0032403 |
F |
protein-containing complex binding |
| GO:0035372 |
P |
protein localization to microtubule |
| GO:0042995 |
C |
cell projection |
| GO:0043025 |
C |
neuronal cell body |
| GO:0043197 |
C |
dendritic spine |
| GO:0043198 |
C |
dendritic shaft |
| GO:0045184 |
P |
establishment of protein localization |
| GO:0045202 |
C |
synapse |
| GO:0097110 |
F |
scaffold protein binding |
| GO:1902897 |
P |
regulation of postsynaptic density protein 95 clustering |
|
| RNA-seq Entry | A_SariASG_c36245_g1_i1 |
Sequence
(Amino Acid) | MVCEKCEKKLGRVITPDPWKTGARNTVESGGRKVGENKALTAKKGRYNPYTSKFQECKIC
RTKVHQVGSHYCQACAYKKGICAMCGKKILDTKNYRQSST
*(32 a.a.) |
