SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG11344_complete:A_SariASG_c36110_g1_i3
Scaffold_id
NCBI non-redundant
(nr)
DNA_repair_endonuclease_XPF-like_[Bombyx_mori]
Ontology
GO:0000014 F single-stranded DNA endodeoxyribonuclease activity
GO:0000110 C nucleotide-excision repair factor 1 complex
GO:0000712 P resolution of meiotic recombination intermediates
GO:0000724 P double-strand break repair via homologous recombination
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003684 F damaged DNA binding
GO:0003697 F single-stranded DNA binding
GO:0004518 F nuclease activity
GO:0004519 F endonuclease activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0006259 P DNA metabolic process
GO:0006281 P DNA repair
GO:0006289 P nucleotide-excision repair
GO:0006296 P nucleotide-excision repair, DNA incision, 5'-to lesion
GO:0006298 P mismatch repair
GO:0006302 P double-strand break repair
GO:0006310 P DNA recombination
GO:0006974 P cellular response to DNA damage stimulus
GO:0007095 P mitotic G2 DNA damage checkpoint signaling
GO:0007131 P reciprocal meiotic recombination
GO:0007143 P female meiotic nuclear division
GO:0016321 P female meiosis chromosome segregation
GO:0016787 F hydrolase activity
GO:0043234 C protein-containing complex
GO:0045132 P meiotic chromosome segregation
GO:0046982 F protein heterodimerization activity
GO:0051321 P meiotic cell cycle
GO:1901255 P nucleotide-excision repair involved in interstrand cross-link repair
RNA-seq EntryA_SariASG_c36110_g1_i3
Sequence
(Amino Acid)
MSRNYSRPILLIEFDQNKPFNLQGHYVVSTDTAGADIQQKLQLLTIHFPRLKLVWSPSPY
ATAELFYELKQGRQNPNIEEALAHSSENAADDMQHERYNTSIHDFVQKLPGVTTKNITRL
MNKGVSLDHLITLTLEQLTDIIENKNEAETLHSILHVKALPQDATNQNEKPFGKKKFTGK
FYTK
*(60 a.a.)

- SilkBase 1999-2023 -