SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG11198_5prime_partial:A_SariASG_c36031_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		two_pore_calcium_channel_protein_1-like_isoform_X2_[Helicoverpa_armigera]
Ontology
GO:0003674 F molecular_function
GO:0005216 F ion channel activity
GO:0005244 F voltage-gated ion channel activity
GO:0005245 F voltage-gated calcium channel activity
GO:0005262 F calcium channel activity
GO:0005575 C cellular_component
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005768 C endosome
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006816 P calcium ion transport
GO:0008150 P biological_process
GO:0010008 C endosome membrane
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0034765 P regulation of ion transmembrane transport
GO:0051209 P release of sequestered calcium ion into cytosol
GO:0055085 P transmembrane transport
GO:0070588 P calcium ion transmembrane transport
GO:0072345 F NAADP-sensitive calcium-release channel activity
GO:0086010 P membrane depolarization during action potential
RNA-seq EntryA_SariASG_c36031_g1_i1
Sequence
(Amino Acid)
DSGTLDMGSRSSLHTGLHMSEDEHWEMNYHEAAIYLEEGLNNEKFDSHPSSPEELPAYLR
VHNPWYHGLDLLASLVLILLAFTEDPAVPTFELPVWAHGTIELMALAIIGVELHLKLKWI
GWSTILNIREL
*(43 a.a.)

- SilkBase 1999-2023 -