| Name | O_SariASG1118_internal:A_SariASG_c9875_g1_i1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | peroxidase_isoform_X1_[Bombyx_mori] |
| Ontology |
| GO:0004601 |
F |
peroxidase activity |
| GO:0005506 |
F |
iron ion binding |
| GO:0005576 |
C |
extracellular region |
| GO:0006909 |
P |
phagocytosis |
| GO:0006979 |
P |
response to oxidative stress |
| GO:0007306 |
P |
eggshell chorion assembly |
| GO:0016491 |
F |
oxidoreductase activity |
| GO:0020037 |
F |
heme binding |
| GO:0022008 |
P |
neurogenesis |
| GO:0042600 |
C |
egg chorion |
| GO:0042744 |
P |
hydrogen peroxide catabolic process |
| GO:0045471 |
P |
response to ethanol |
| GO:0046872 |
F |
metal ion binding |
| GO:0055114 |
P |
obsolete oxidation-reduction process |
| GO:0098869 |
P |
cellular oxidant detoxification |
|
| RNA-seq Entry | A_SariASG_c9875_g1_i1 |
Sequence
(Amino Acid) | RNVPNGIVGTNAFTIWFWRYHNYVARILAALNPCWNDDLLFYTTREIVIVVYLQIYYYDF
LPHLLGRKNMINMDLISDDPGHRDLHDPDVIAQIAVEYAYLFRYFH
(34 a.a.) |
