SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG11149_complete:A_SariASG_c36013_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		cell_division_cycle_and_apoptosis_regulator_protein_1_[Bombyx_mori]
Ontology
GO:0000790 C chromatin
GO:0000993 F RNA polymerase II complex binding
GO:0004857 F enzyme inhibitor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005681 C spliceosomal complex
GO:0005737 C cytoplasm
GO:0005759 C mitochondrial matrix
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006397 P mRNA processing
GO:0006915 P apoptotic process
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0008380 P RNA splicing
GO:0009411 P response to UV
GO:0016055 P Wnt signaling pathway
GO:0019899 F enzyme binding
GO:0030308 P negative regulation of cell growth
GO:0031647 P regulation of protein stability
GO:0032435 P negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032784 P regulation of DNA-templated transcription, elongation
GO:0042752 P regulation of circadian rhythm
GO:0043065 P positive regulation of apoptotic process
GO:0043086 P negative regulation of catalytic activity
GO:0043653 P mitochondrial fragmentation involved in apoptotic process
GO:0044609 C DBIRD complex
GO:0044822 F RNA binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0048511 P rhythmic process
GO:0090263 P positive regulation of canonical Wnt signaling pathway
GO:0090311 P regulation of protein deacetylation
GO:1900034 P regulation of cellular response to heat
GO:1902230 P negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage
GO:2000003 P positive regulation of DNA damage checkpoint
RNA-seq EntryA_SariASG_c36013_g1_i1
Sequence
(Amino Acid)
MNNWSVNKNMQSGSGTKNPPWARSNVNTNMTGINPQIMDPNAMMSQQGIMPFQQTQTMFN
PMQTQGGMAMPMAGQMPMSQMTQGQIYPGNVVAYPTPRAMNPGMYQNVQANQTTANAEQR
VFTGTVTKTHNDFGFIDHDVFYQTSVCAKGIIPKMNDRVLVEATYNPNMPFKWNATRVQV
LPKTVSVQKPAPSKSNSYNAVPPPSAKKPIPRRDDRPPRRDDRKRSRTRSRSRSRDRRDS
RNRRDSPPRKRSVVRQPSPIKYVVRVPRMPLDIQKVDVPSLSQRYNNLYIPSDFFNAYVK
WGEAFPPQAPFSLNNPCSYHIMNKDIEHPNGNDAVLEPSDADYKFSAKVMLISMPTLETL
YQKCGLTKSDEKEKRSTSSKSPLHPTRLIKFLVGQKGKSGENFAIGGPWSPSLDGENPES
DPQVLVKTAIRTCKALTGIDLSSCTQWKRLILMMVQ
*(151 a.a.)

- SilkBase 1999-2023 -