SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG1113_internal:A_SariASG_c9853_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		gastrula_zinc_finger_protein_XlCGF8.2DB-like_[Helicoverpa_armigera]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000982 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001227 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0005667 C transcription regulator complex
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
RNA-seq EntryA_SariASG_c9853_g1_i1
Sequence
(Amino Acid)
LISNHDEPIKKRFGLGVTPYIITDEGYTCAFCDEKFVVFTSINTHLNIHNPNSICPLCGK
AFSSNQRLKAHLTIHNAEDGDHKCAKCGEVFPSLALKNEHFVAQHAP
(34 a.a.)

- SilkBase 1999-2023 -