SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG1102_internal:A_SariASG_c9682_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		Ca(2+)/calmodulin-responsive_adenylate_cyclase_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0001661 P conditioned taste aversion
GO:0004016 F adenylate cyclase activity
GO:0005516 F calmodulin binding
GO:0005524 F ATP binding
GO:0005622 C intracellular anatomical structure
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006171 P cAMP biosynthetic process
GO:0006979 P response to oxidative stress
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007189 P adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007193 P adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007268 P chemical synaptic transmission
GO:0007274 P neuromuscular synaptic transmission
GO:0007528 P neuromuscular junction development
GO:0007591 P molting cycle, chitin-based cuticle
GO:0007611 P learning or memory
GO:0007612 P learning
GO:0007613 P memory
GO:0007614 P short-term memory
GO:0007617 P mating behavior
GO:0007619 P courtship behavior
GO:0007625 P grooming behavior
GO:0008294 F calcium- and calmodulin-responsive adenylate cyclase activity
GO:0008306 P associative learning
GO:0008340 P determination of adult lifespan
GO:0008355 P olfactory learning
GO:0009190 P cyclic nucleotide biosynthetic process
GO:0009408 P response to heat
GO:0010738 P regulation of protein kinase A signaling
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016829 F lyase activity
GO:0016849 F phosphorus-oxygen lyase activity
GO:0019933 P cAMP-mediated signaling
GO:0030431 P sleep
GO:0035556 P intracellular signal transduction
GO:0046872 F metal ion binding
GO:0048149 P behavioral response to ethanol
GO:0048675 P axon extension
GO:0090328 P regulation of olfactory learning
RNA-seq EntryA_SariASG_c9682_g1_i1
Sequence
(Amino Acid)
PRACWLALAGGGAALAATLPAWSPGAAAEGAVHVVWAVFAAYALLPVGGPVAAAFGVLLP
TAHTIAAALVAHRFPYHVWQQMVGNVVVFLCVNVVGALMHSLMETAQRRTFLDTRNCIAA
RLDMEDENEKLERLLLSVLPQHVAMEMKNDIISPVEGQFHKIYIKKHE
(55 a.a.)

- SilkBase 1999-2023 -