SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG1095_internal:A_SariASG_c9614_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		mCG10529,_isoform_CRA_b,_partial_[Mus_musculus]
Ontology
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0005886 C plasma membrane
GO:0006281 P DNA repair
GO:0006338 P chromatin remodeling
GO:0006342 P heterochromatin assembly
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006974 P cellular response to DNA damage stimulus
GO:0016568 P chromatin organization
GO:0016575 P histone deacetylation
GO:0035267 C NuA4 histone acetyltransferase complex
GO:0040008 P regulation of growth
GO:0043967 P histone H4 acetylation
GO:0043968 P histone H2A acetylation
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0051155 P positive regulation of striated muscle cell differentiation
RNA-seq EntryA_SariASG_c9614_g1_i1
Sequence
(Amino Acid)
NPPSGSVRKTRKNKQKAPGNGDGGSTSEVPQPPRKKRARADPTVESEEVFKSRMEVKVKI
PEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVG
(38 a.a.)

- SilkBase 1999-2023 -