SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG10933_3prime_partial:A_SariASG_c35892_g1_i4
Scaffold_id
NCBI non-redundant
(nr)
dorsalA_[Antheraea_pernyi]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000381 P regulation of alternative mRNA splicing, via spliceosome
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001715 P ectodermal cell fate specification
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003705 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0006952 P defense response
GO:0006954 P inflammatory response
GO:0006955 P immune response
GO:0006964 P positive regulation of biosynthetic process of antibacterial peptides active against Gram-negative bacteria
GO:0007249 P I-kappaB kinase/NF-kappaB signaling
GO:0007275 P multicellular organism development
GO:0007369 P gastrulation
GO:0007398 P ectoderm development
GO:0007419 P ventral cord development
GO:0007498 P mesoderm development
GO:0007501 P mesodermal cell fate specification
GO:0007507 P heart development
GO:0008063 P Toll signaling pathway
GO:0008354 P germ cell migration
GO:0008358 P maternal determination of anterior/posterior axis, embryo
GO:0009950 P dorsal/ventral axis specification
GO:0009952 P anterior/posterior pattern specification
GO:0009953 P dorsal/ventral pattern formation
GO:0010004 P gastrulation involving germ band extension
GO:0010629 P negative regulation of gene expression
GO:0010906 P regulation of glucose metabolic process
GO:0016015 F morphogen activity
GO:0031594 C neuromuscular junction
GO:0033256 C I-kappaB/NF-kappaB complex
GO:0034097 P response to cytokine
GO:0035006 P melanization defense response
GO:0035206 P regulation of hemocyte proliferation
GO:0038061 P NIK/NF-kappaB signaling
GO:0042387 P plasmatocyte differentiation
GO:0043565 F sequence-specific DNA binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048935 P peripheral nervous system neuron development
GO:0070379 F high mobility group box 1 binding
GO:0070491 F DNA-binding transcription factor binding
RNA-seq EntryA_SariASG_c35892_g1_i4
Sequence
(Amino Acid)
MDIGGDAVIIGNAERIDNDQPQDLNISDVFEAISLADPTFGAGVAAVEDAMAHQPSQVQQ
APYVRIVQQPASKALRFRYECEGRSAGSIPGASSTPENRTYPTIKIYGYTGLVTIVVSCV
TKDEPFRPHPHNLVGRDRCDRGVCTIRTEITEENNEYQFRNLGIQCVKRRDIAEALRIRE
ELRVDPFRTGFSHRNHPQSIDLNAVRLGFQVFLPDATGKMRRSLAPVASEVIYDKKAMSD
LLIMRASHCSGRARGGTQVILLCEKVTREDTAVVFYQEENNQIVWEETAIILLVHKQVAI
AFETPAYKNPHITEHVNVRFQLKRLTDNARSNSQPFEYYPEFQDPNYIGSKRRKTLIPSL
LQSAYEPERFPHEQKTIKVEREKTPPHPMSVSPTLNVYTQYAQQNWAMNIDMQSVLAEPG
PSHVAYQEMPWATGPYGQSLGPSIQQGNMSGIPPNMQQVHSPNIKQQVHSPNIQQVHSPN
IQQVHSPNIQQVHSPNIQQ
(165 a.a.)

- SilkBase 1999-2023 -