SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG10874_3prime_partial:A_SariASG_c35858_g2_i1
Scaffold_id
NCBI non-redundant
(nr)
ras-related_GTP_binding_protein_[Bombyx_mori]
Ontology
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0000139 C Golgi membrane
GO:0000166 F nucleotide binding
GO:0003924 F GTPase activity
GO:0005525 F GTP binding
GO:0005575 C cellular_component
GO:0005622 C intracellular anatomical structure
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0005975 P carbohydrate metabolic process
GO:0006629 P lipid metabolic process
GO:0007165 P signal transduction
GO:0007264 P small GTPase mediated signal transduction
GO:0007411 P axon guidance
GO:0007430 P terminal branching, open tracheal system
GO:0007446 P imaginal disc growth
GO:0010506 P regulation of autophagy
GO:0010507 P negative regulation of autophagy
GO:0012505 C endomembrane system
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016049 P cell growth
GO:0030307 P positive regulation of cell growth
GO:0032008 P positive regulation of TOR signaling
GO:0035264 P multicellular organism growth
GO:0042254 P ribosome biogenesis
GO:0042331 P phototaxis
GO:0042594 P response to starvation
GO:0045176 P apical protein localization
GO:0045727 P positive regulation of translation
GO:0045793 P positive regulation of cell size
GO:0046872 F metal ion binding
GO:0051124 P synaptic assembly at neuromuscular junction
GO:0090070 P positive regulation of ribosome biogenesis
GO:2000377 P regulation of reactive oxygen species metabolic process
RNA-seq EntryA_SariASG_c35858_g2_i1
Sequence
(Amino Acid)
MPSKQRKIAMMGYRSVGKSSLIIQFVEGQFVDSYDPTIENTFTKYIRLNSTEYEVKLVDT
AGQDEYSIFPLQYSMDFHGYVLVYSITSSKSFQIVQIIYDKLLDMIGKIHVPIVLVGNKT
DLHLERKISTERSEER
(44 a.a.)

- SilkBase 1999-2023 -