SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG10831_internal:A_SariASG_c35803_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
protein_suppressor_2_of_zeste-like_[Helicoverpa_armigera]
Ontology
GO:0000076 P DNA replication checkpoint signaling
GO:0000079 P regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0000083 P regulation of transcription involved in G1/S transition of mitotic cell cycle
GO:0000166 F nucleotide binding
GO:0000922 C spindle pole
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0006260 P DNA replication
GO:0006270 P DNA replication initiation
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0007089 P traversing start control point of mitotic cell cycle
GO:0008156 P negative regulation of DNA replication
GO:0008285 P negative regulation of cell population proliferation
GO:0019900 F kinase binding
GO:0030071 P regulation of mitotic metaphase/anaphase transition
GO:0032467 P positive regulation of cytokinesis
GO:0045737 P positive regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0048146 P positive regulation of fibroblast proliferation
GO:0051233 C spindle midzone
GO:0051301 P cell division
GO:0051984 P positive regulation of chromosome segregation
GO:1904117 P cellular response to vasopressin
GO:1904385 P cellular response to angiotensin
RNA-seq EntryA_SariASG_c35803_g1_i1
Sequence
(Amino Acid)
VLFRSLQMLAAKIAAISGDMRRALDIGRRVIELARRSNFSNNRCVDNIMKDNAVTVELKE
VLQVLNDVYGGSRKIDTDVDEGFPMQQKLILCSLMLMLTKGKNKDIVMGKLHDVYKKVAE
ARNIGALDMGEMSSACSLLESRGAVRVAGSGAGG
(50 a.a.)

- SilkBase 1999-2023 -