EntryView

ORF from Assembled RNA_seq Entry

Name

O_SariASG1080_complete:A_SariASG_c9423_g1_i1

Scaffold_id

NCBI non-redundant
(nr)

high_mobility_group_protein_HMG-I/HMG-Y_isoform_a_[Mus_musculus]

Ontology

GO:0000785	C	chromatin
GO:0001077	F	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001205	F	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003677	F	DNA binding
GO:0003680	F	minor groove of adenine-thymine-rich DNA binding
GO:0003682	F	chromatin binding
GO:0003906	F	DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0005634	C	nucleus
GO:0005694	C	chromosome
GO:0005925	C	focal adhesion
GO:0006284	P	base-excision repair
GO:0006351	P	transcription, DNA-templated
GO:0006355	P	regulation of transcription, DNA-templated
GO:0006366	P	transcription by RNA polymerase II
GO:0007283	P	spermatogenesis
GO:0008134	F	transcription factor binding
GO:0008285	P	negative regulation of cell population proliferation
GO:0019899	F	enzyme binding
GO:0030374	F	nuclear receptor coactivator activity
GO:0035985	C	senescence-associated heterochromatin focus
GO:0035986	P	obsolete senescence-associated heterochromatin focus assembly
GO:0042974	F	retinoic acid receptor binding
GO:0042975	F	peroxisome proliferator activated receptor binding
GO:0045892	P	negative regulation of transcription, DNA-templated
GO:0045893	P	positive regulation of transcription, DNA-templated
GO:0045944	P	positive regulation of transcription by RNA polymerase II
GO:0046965	F	retinoid X receptor binding
GO:0051575	F	5'-deoxyribose-5-phosphate lyase activity
GO:0090402	P	oncogene-induced cell senescence
GO:0090575	C	RNA polymerase II transcription regulator complex
GO:2000774	P	positive regulation of cellular senescence

RNA-seq Entry

Sequence
(Amino Acid)

MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGR
PKGSKNKGAAKTRKVTPAPGRKPRGRPKKLEKEEEEGISQESSEEEQ
*(35 a.a.)

- SilkBase 1999-2023 -