SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG10723_internal:A_SariASG_c35717_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		tyrosine-protein_kinase_JAK2_isoform_X3_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0001745 P compound eye morphogenesis
GO:0001751 P compound eye photoreceptor cell differentiation
GO:0003383 P apical constriction
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004715 F non-membrane spanning protein tyrosine kinase activity
GO:0005102 F signaling receptor binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006468 P protein phosphorylation
GO:0006952 P defense response
GO:0006955 P immune response
GO:0006959 P humoral immune response
GO:0006968 P cellular defense response
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007259 P receptor signaling pathway via JAK-STAT
GO:0007260 P tyrosine phosphorylation of STAT protein
GO:0007262 P regulation of receptor signaling pathway via JAK-STAT
GO:0007275 P multicellular organism development
GO:0007298 P border follicle cell migration
GO:0007350 P blastoderm segmentation
GO:0007365 P periodic partitioning
GO:0007399 P nervous system development
GO:0007424 P open tracheal system development
GO:0007442 P hindgut morphogenesis
GO:0007455 P eye-antennal disc morphogenesis
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007480 P imaginal disc-derived leg morphogenesis
GO:0007530 P sex determination
GO:0007538 P primary sex determination
GO:0007616 P long-term memory
GO:0008283 P cell population proliferation
GO:0012505 C endomembrane system
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016318 P ommatidial rotation
GO:0016476 P regulation of embryonic cell shape
GO:0016740 F transferase activity
GO:0019827 P stem cell population maintenance
GO:0030097 P hemopoiesis
GO:0030707 P ovarian follicle cell development
GO:0030713 P ovarian follicle cell stalk formation
GO:0031234 C extrinsic component of cytoplasmic side of plasma membrane
GO:0035010 P encapsulation of foreign target
GO:0035167 P larval lymph gland hemopoiesis
GO:0035171 P lamellocyte differentiation
GO:0035172 P hemocyte proliferation
GO:0035206 P regulation of hemocyte proliferation
GO:0038083 P peptidyl-tyrosine autophosphorylation
GO:0042067 P establishment of ommatidial planar polarity
GO:0042078 P germ-line stem cell division
GO:0042386 P hemocyte differentiation
GO:0045087 P innate immune response
GO:0045317 P equator specification
GO:0045475 P locomotor rhythm
GO:0045610 P regulation of hemocyte differentiation
GO:0046425 P regulation of receptor signaling pathway via JAK-STAT
GO:0048103 P somatic stem cell division
GO:0048477 P oogenesis
GO:0048749 P compound eye development
GO:0051607 P defense response to virus
GO:0060031 P mediolateral intercalation
RNA-seq EntryA_SariASG_c35717_g1_i1
Sequence
(Amino Acid)
AGLARALWDLSEAGVVHGYIRCRRLLLAAHDADRIQVKLSGPALHQYTNHDVHWIPVEFF
SDMNLSKRSVIGDIWAFATTLWEVFSYGQSPTETNPVMTARSYEMGDRLLRPARCPGEVW
ALMRQCWQSDPLRPQEIMRDMNHMLHREYVPIHEYEEPKISLDHMEHTETVSSDRFIPSE
LSDAGSNKSLISDNSVLSMNGTMSDQYDNPFADNKSSNSLESMNALAYALRNEISSCRSN
S
(79 a.a.)

- SilkBase 1999-2023 -