SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_SariASG10633_internal:A_SariASG_c35614_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
F-actin-methionine_sulfoxide_oxidase_Mical_isoform_X3_[Helicoverpa_armigera]
Ontology
GO:0003779 F actin binding
GO:0004497 F monooxygenase activity
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0007015 P actin filament organization
GO:0007411 P axon guidance
GO:0007526 P larval somatic muscle development
GO:0008270 F zinc ion binding
GO:0016322 P neuron remodeling
GO:0016491 F oxidoreductase activity
GO:0016709 F oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0019417 P sulfur oxidation
GO:0030042 P actin filament depolymerization
GO:0030047 P actin modification
GO:0043195 C terminal bouton
GO:0043914 F NADPH:sulfur oxidoreductase activity
GO:0045214 P sarcomere organization
GO:0046872 F metal ion binding
GO:0048813 P dendrite morphogenesis
GO:0055114 P obsolete oxidation-reduction process
GO:0060386 P synapse assembly involved in innervation
GO:0070995 P NADPH oxidation
GO:0071949 F FAD binding
GO:1904799 P regulation of neuron remodeling
RNA-seq EntryA_SariASG_c35614_g1_i1
Sequence
(Amino Acid)
VAQLAAELSGTTTNADSTHVPSKPKDLIRSVGKIEPDDWNMKKIERKIQENKLGRPEPKI
AEKVPKWDREQFLGRQRRLKEGEGSEKWVEIDERLHKLDQKLRDSGRPDHGTNKVANLAT
KFVKKDDPEPKIEQQKEEEI
(45 a.a.)

- SilkBase 1999-2023 -