SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG10632_5prime_partial:A_SariASG_c35612_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		putative_BR_serine/threonine-protein_kinase,_partial_[Danaus_plexippus_plexippus]
Ontology
GO:0000086 P G2/M transition of mitotic cell cycle
GO:0000166 F nucleotide binding
GO:0000287 F magnesium ion binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005856 C cytoskeleton
GO:0006468 P protein phosphorylation
GO:0006887 P exocytosis
GO:0006915 P apoptotic process
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0007399 P nervous system development
GO:0007409 P axonogenesis
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018105 P peptidyl-serine phosphorylation
GO:0019901 F protein kinase binding
GO:0030010 P establishment of cell polarity
GO:0030182 P neuron differentiation
GO:0031532 P actin cytoskeleton reorganization
GO:0036503 P ERAD pathway
GO:0043462 P regulation of ATP-dependent activity
GO:0046872 F metal ion binding
GO:0048471 C perinuclear region of cytoplasm
GO:0048812 P neuron projection morphogenesis
GO:0050321 F tau-protein kinase activity
GO:0051117 F ATPase binding
GO:0051301 P cell division
GO:0060590 F ATPase regulator activity
GO:0061178 P regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0070059 P intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
GO:1904152 P regulation of retrograde protein transport, ER to cytosol
RNA-seq EntryA_SariASG_c35612_g1_i2
Sequence
(Amino Acid)
RSAELSHSALSPMSFRVEYKRGSNAPAMFQRHVRFQVDISTITKAPGENGKEYLYAITFT
LLSGNIRRFRRVCEVVQAAVCRAPGTGRAPPQPSIRQHQHPPSPRAQRRNIHPHGGNEIP
DSPENPHQQSDQDSDSSVFDTVKSPTSHTSIDQLEQNGTHPLGSSSSVTSTSSGYKQGGR
RRTAEPASASLDHEIMSCGRDLPGTNTKRSSSECREVTSSPRRGIEHTTRDNLRRNNSLR
DRDATPPTTTIA
*(83 a.a.)

- SilkBase 1999-2023 -