SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG10589_complete:A_SariASG_c35574_g1_i3
Scaffold_id
NCBI non-redundant
(nr)		adenosine_receptor_A2b_[Helicoverpa_armigera]
Ontology
GO:0001609 F G protein-coupled adenosine receptor activity
GO:0001973 P G protein-coupled adenosine receptor signaling pathway
GO:0002882 P positive regulation of chronic inflammatory response to non-antigenic stimulus
GO:0004871 F obsolete signal transducer activity
GO:0004930 F G protein-coupled receptor activity
GO:0005886 C plasma membrane
GO:0007165 P signal transduction
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007189 P adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0010575 P positive regulation of vascular endothelial growth factor production
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030819 P obsolete positive regulation of cAMP biosynthetic process
GO:0030828 P obsolete positive regulation of cGMP biosynthetic process
GO:0031284 P positive regulation of guanylate cyclase activity
GO:0031668 P cellular response to extracellular stimulus
GO:0032722 P positive regulation of chemokine production
GO:0032755 P positive regulation of interleukin-6 production
GO:0043306 P positive regulation of mast cell degranulation
GO:0060087 P relaxation of vascular associated smooth muscle
RNA-seq EntryA_SariASG_c35574_g1_i3
Sequence
(Amino Acid)
MSYNYLLFLYFATIVTPSVLLAAFYAHIYRVVVKQLSEVMTVGGSRGRISGGGTMLRVLG
AAQKREVKATQNLAVIVFFFILCWMPLYTVNATKAFMPSLDIPNTLTYFCIIFSHLNSAI
NPLLYAYHLKDFRAAMKGLLCSMIGRGVPIPTAYRPPVPIRRPALERCNALRERPRIYVH
SPVWLHQRENECSIAEENGVAEATVAIVPDVEPFLNKVESSSGCYTPDSRDIEADPYLIE
SNEERCQSPYKKVEELIRRVRSVSGEHS
*(88 a.a.)

- SilkBase 1999-2023 -