SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG10528_internal:A_SariASG_c35532_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		Replication_factor_C_38kD_subunit_[Operophtera_brumata]
Ontology
GO:0000722 P telomere maintenance via recombination
GO:0000731 P DNA synthesis involved in DNA repair
GO:0003677 F DNA binding
GO:0003689 F DNA clamp loader activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005663 C DNA replication factor C complex
GO:0006260 P DNA replication
GO:0006271 P DNA strand elongation involved in DNA replication
GO:0006283 P transcription-coupled nucleotide-excision repair
GO:0006296 P nucleotide-excision repair, DNA incision, 5'-to lesion
GO:0006297 P nucleotide-excision repair, DNA gap filling
GO:0016887 F ATP hydrolysis activity
GO:0019985 P translesion synthesis
GO:0031390 C Ctf18 RFC-like complex
GO:0033683 P nucleotide-excision repair, DNA incision
GO:0042276 P error-prone translesion synthesis
GO:0042769 P obsolete DNA damage response, detection of DNA damage
GO:0043142 F single-stranded DNA helicase activity
GO:0046683 P response to organophosphorus
GO:0070987 P error-free translesion synthesis
GO:1900264 P positive regulation of DNA-directed DNA polymerase activity
GO:1901796 P regulation of signal transduction by p53 class mediator
RNA-seq EntryA_SariASG_c35532_g1_i1
Sequence
(Amino Acid)
CALPIFAIVLQLVSKKECLNLPLELAIRISNCADRNLRRALLMCEACKVQQYPFTVDQKI
PEPDWQIFIRETASMILSEQSPKKLSEVRQKLYELIIHGIPPDMIFAGLLKELVRNCDMA
MKCQVASHAARYEHRMRLGNKPIFHLEAFIAKFMAIYKKFVEESLGD
(54 a.a.)

- SilkBase 1999-2023 -