SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG10475_3prime_partial:A_SariASG_c35470_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		folliculin_[Helicoverpa_armigera]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001932 P regulation of protein phosphorylation
GO:0001934 P positive regulation of protein phosphorylation
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0007043 P cell-cell junction assembly
GO:0010629 P negative regulation of gene expression
GO:0010823 P negative regulation of mitochondrion organization
GO:0030097 P hemopoiesis
GO:0030308 P negative regulation of cell growth
GO:0030336 P negative regulation of cell migration
GO:0030496 C midbody
GO:0030511 P positive regulation of transforming growth factor beta receptor signaling pathway
GO:0031929 P TOR signaling
GO:0032006 P regulation of TOR signaling
GO:0032007 P negative regulation of TOR signaling
GO:0032008 P positive regulation of TOR signaling
GO:0032403 F protein-containing complex binding
GO:0032465 P regulation of cytokinesis
GO:0035024 P negative regulation of Rho protein signal transduction
GO:0035065 P regulation of histone acetylation
GO:0043065 P positive regulation of apoptotic process
GO:0043547 P positive regulation of GTPase activity
GO:0044291 C cell-cell contact zone
GO:0045785 P positive regulation of cell adhesion
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0051898 P negative regulation of protein kinase B signaling
GO:0070373 P negative regulation of ERK1 and ERK2 cascade
GO:1900181 P negative regulation of protein localization to nucleus
GO:1901723 P negative regulation of cell proliferation involved in kidney development
GO:2000506 P energy homeostasis
GO:2000973 P regulation of pro-B cell differentiation
GO:2001170 P negative regulation of ATP biosynthetic process
RNA-seq EntryA_SariASG_c35470_g1_i1
Sequence
(Amino Acid)
MNAIVGLCHFCEAHGPRPLFCTFTTDNERDTTEPSKISVQCNGCTSLGPETVLVSRDEYS
TIFCSRESVPNVDVTKFLRQAAIRSITCEVCWSKEGGVVYFSDTQGHVLSLTFQLRDTRA
RGLKRWFSIIVLMKDKMLLLNITPLLSEHMQKIAKELQQLADVVYDEEQKVCSQRSLRLK
TGRNDFGQSRSLMQLTGNDNVFKTLHSHFTWMLKAGANTYSETLYTSQDMLNKLHPEVKK
DEKYGTDRKS
(82 a.a.)

- SilkBase 1999-2023 -