SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG1041_internal:A_SariASG_c9091_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		probable_G-protein_coupled_receptor_Mth-like_1,_partial_[Helicoverpa_armigera]
Ontology
GO:0004871 F obsolete signal transducer activity
GO:0004888 F transmembrane signaling receptor activity
GO:0004930 F G protein-coupled receptor activity
GO:0005886 C plasma membrane
GO:0007165 P signal transduction
GO:0007166 P cell surface receptor signaling pathway
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007369 P gastrulation
GO:0007472 P wing disc morphogenesis
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007509 P mesoderm migration involved in gastrulation
GO:0008340 P determination of adult lifespan
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0042594 P response to starvation
GO:0070252 P actin-mediated cell contraction
RNA-seq EntryA_SariASG_c9091_g1_i1
Sequence
(Amino Acid)
GDMEILVYFFGPVGVLLLVNLALFVSTTRQLTCGLWRRDEVKSTSERAALGRVCAKLVVV
MGVTWGADVISWAAGGPEYVWYATDLLNALQGVFIFLVVGCQPHA
(34 a.a.)

- SilkBase 1999-2023 -