SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_SariASG1017_internal:A_SariASG_c8921_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		ionotropic_glutamate_receptor,_partial_[Ostrinia_furnacalis]
Ontology
GO:0001508 P action potential
GO:0001975 P response to amphetamine
GO:0004872 F signaling receptor activity
GO:0004970 F ionotropic glutamate receptor activity
GO:0004972 F NMDA glutamate receptor activity
GO:0005102 F signaling receptor binding
GO:0005149 F interleukin-1 receptor binding
GO:0005216 F ion channel activity
GO:0005234 F extracellularly glutamate-gated ion channel activity
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0007611 P learning or memory
GO:0007613 P memory
GO:0007616 P long-term memory
GO:0008013 F beta-catenin binding
GO:0008144 F obsolete drug binding
GO:0008270 F zinc ion binding
GO:0008306 P associative learning
GO:0009612 P response to mechanical stimulus
GO:0009636 P response to toxic substance
GO:0009743 P response to carbohydrate
GO:0010042 P response to manganese ion
GO:0010350 P cellular response to magnesium starvation
GO:0010942 P positive regulation of cell death
GO:0014049 P positive regulation of glutamate secretion
GO:0014069 C postsynaptic density
GO:0014070 P response to organic cyclic compound
GO:0014075 P response to amine
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0017146 C NMDA selective glutamate receptor complex
GO:0021766 P hippocampus development
GO:0021987 P cerebral cortex development
GO:0030018 C Z disc
GO:0030054 C cell junction
GO:0031749 F D2 dopamine receptor binding
GO:0032026 P response to magnesium ion
GO:0033555 P multicellular organismal response to stress
GO:0034097 P response to cytokine
GO:0034220 P ion transmembrane transport
GO:0035235 P ionotropic glutamate receptor signaling pathway
GO:0035255 F ionotropic glutamate receptor binding
GO:0042165 F neurotransmitter binding
GO:0042220 P response to cocaine
GO:0042734 C presynaptic membrane
GO:0043005 C neuron projection
GO:0043083 C synaptic cleft
GO:0043113 P receptor clustering
GO:0043195 C terminal bouton
GO:0043197 C dendritic spine
GO:0043408 P regulation of MAPK cascade
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0045471 P response to ethanol
GO:0046872 F metal ion binding
GO:0046982 F protein heterodimerization activity
GO:0048169 P regulation of long-term neuronal synaptic plasticity
GO:0048511 P rhythmic process
GO:0050806 P positive regulation of synaptic transmission
GO:0050839 F cell adhesion molecule binding
GO:0051592 P response to calcium ion
GO:0051597 P response to methylmercury
GO:0051602 P response to electrical stimulus
GO:0051707 P response to other organism
GO:0060416 P response to growth hormone
GO:0060992 P response to fungicide
GO:0071230 P cellular response to amino acid stimulus
GO:0071287 P cellular response to manganese ion
GO:0071359 P cellular response to dsRNA
GO:0071363 P cellular response to growth factor stimulus
GO:0071396 P cellular response to lipid
GO:0071407 P cellular response to organic cyclic compound
RNA-seq EntryA_SariASG_c8921_g1_i1
Sequence
(Amino Acid)
VGSWYAMSGYGLAFTRNSKYLSMFNKRLLDLRSNGDLERLRRYWMTGTCKPNKQEHKSSD
PLALEQFLSAFLLLMAGILLAALLLLLEHVFFRYMRTHLAASSVGSCCALVSLSMGQSLS
FHGAVVEAAARGLGAGGRGHCRSAIC
(47 a.a.)

- SilkBase 1999-2023 -